Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,699 results found for hug

lovehug friendshandshakefamilyfriendshappycouple hugsadsmilefamily hug
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Rear view of adult daughter hugging happy senior mother indoors at home.

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Embracing Love: Real Emotions, Positive Atmosphere

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

Close-up of woman giving a warm hug to a man outdoors

Couple is hugging. Hands of man and woman. Give more hugs.

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

Medium Shot - Two men greet and hug each other at a park - shot on RED

Portrait of couple hands, sitting on sofa at home in the living room.

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

Couple embracing after conflict, showing support and forgiveness in living room

Smiling woman embraces child and chats on veranda deck of hotel building at resort in spring - closeup, slow motion

A Joyful Evening on the Beach: Couple Embracing

Happy couple hugging in the city, slow motion, shot at 60fps

Loving couple sharing affectionate moment while strolling together

Senior couple hugging in the city during sunset, 120fps

Sunset Silhouette of Couple Embracing at Beach

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

Loving couple embracing outdoors

Dad watches the drawings of his daughter, who sits on his lap. slow motion

Young Asian woman holding cute angora cat with yellow eyes. Female hugging her cute long hair kitty isolated by white background. Adorable domestic pet concept.

Couple embracing at home

Group of Young People Embrace

Young diverse couple enjoying winter walk in snowy forest

Couple at the meadow

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Cool Couple Laughing and hugging In Front Of Beach In autumn

Loving couple sharing affectionate moment while strolling together

Medium shot of affectionate elderly Caucasian woman hugging son or grandson and talking to him

Man and woman hugging. Couple standing indoors. Interesting facts about hugs.

Three friends embracing each other. Heartwarming bond. Meeting in slow motion.

Girl hugging a guy, close-up of hands interlocking on the back of a boyfriend

Father hugs his son on the field at sunset. Slowmo

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

NEW

Teenage girl overtaking young parents and they embracing her while walking in winter forest, back view.

Reunion of diverse friends in apartment, smiling and talking

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

Couple Greeting Each Other With Hug As They Meet In Coffee Shop

Portrait Of Two Sisters Sitting On Sofa At Home Smiling Into Camera

A Couple Embraces in a Stunning Sunset

Concept of love and friendship. Woman and her border collie dog holding hands and looking at each other. Touching moment of sincerity. Dogs are best friends. Relationship between human and animal.

NEW

Sweet friends and sharing a hug after finishing their homework, schoolgirls feeling pleased with their friendship in the library. Cute

Family enjoying autumn walk in the park. Slow motion.

The man and woman standing near vehicle against the sunset. time lapse

Two happy women hug each other when meeting after long separation

Close up of happy senior woman getting gift from friend during celebration outdoors on patio

Over The Shoulder View Of Senior Mother Being Hugged By Adult Daughter At Home