Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,694 results found for hug

lovehug friendshandshakefriendsfamilyhappycouple hugsadsmilefamily hug
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Rear view of adult daughter hugging happy senior mother indoors at home.

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

A young woman embraces a toddler by the ocean at dawn

Embracing Love: Real Emotions, Positive Atmosphere

Close-up of woman giving a warm hug to a man outdoors

Couple is hugging. Hands of man and woman. Give more hugs.

Medium Shot - Two men greet and hug each other at a park - shot on RED

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

A Couple Under a Beautiful Starry Sky: Time Lapse

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

Portrait of couple hands, sitting on sofa at home in the living room.

A Joyful Evening on the Beach: Couple Embracing

Romantic couple shares intimate moment with love and passion

Couple embracing after conflict, showing support and forgiveness in living room

Loving couple sharing affectionate moment while strolling together

Loving couple embracing outdoors

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

Team of professional gamers esportsman with golden trophy smiling and dancing together while celebrating victory in gaming tournament under bright spotlights

Sunset Silhouette of Couple Embracing at Beach

Portrait of diverse young adults in love, smiling outdoors

NEW

Young boy lovingly hugging baby sibling in mother’s arms during a tender family moment on the couch, displaying strong sibling bond and affection, monochrome video.

Senior couple hugging in the city during sunset, 120fps

Group of Young People Embrace

Loving moment: Daughter kisses pregnant mom

Couple embracing at home

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

Happy couple hugging in the city, slow motion, shot at 60fps

Close up shot of senior man and woman in protective masks meeting outdoors and hugging, walking together in city center

Cool Couple Laughing and hugging In Front Of Beach In autumn

Couple at the meadow

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

Medium shot of mother sitting on bed hugging her child, having bonding moment

Man and woman hugging. Couple standing indoors. Interesting facts about hugs.

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Medium shot of affectionate elderly Caucasian woman hugging son or grandson and talking to him

Portrait Of Two Sisters Sitting On Sofa At Home Smiling Into Camera

Joyful couple embracing in the mountains

Happy lesbian mixed race couple embracing and using laptop at home. Lesbian couple concept. African ethnicity girl works out while her partner hugs her

Two lesbian woman lgbt couple hugging, kissing. Concept of LGBT happiness, freedom, love couple.

Three friends embracing each other. Heartwarming bond. Meeting in slow motion.

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Family enjoying autumn walk in the park. Slow motion.

Happy couple embracing on beach, stormy day, 240fps

Concept of love and friendship. Woman and her border collie dog holding hands and looking at each other. Touching moment of sincerity. Dogs are best friends. Relationship between human and animal.

Medium Shot - Two friends embrace - shot on RED

A Couple Embraces in a Stunning Sunset

Close up of happy senior woman getting gift from friend during celebration outdoors on patio